Novus Biologicals
Manufacturer Code:NBP169321
Catalog # NBP169321
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to XYLT2(xylosyltransferase II) The peptide sequence was selected from the middle region of XYLT2. Peptide sequence PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.26 Peptide O-xylosyltransferase 1 PXYLT2 XT2UDP-D-xylose:proteoglycan core protein beta-D-xylosyltransferase xylosyltransferase 2 xylosyltransferase IIXT-IIprotein xylosyltransferase 2 xylT-II; Peptide O-xylosyltransferase 1; protein xylosyltransferase 2; UDP-D-xylose:proteoglycan core protein beta-D-xylosyltransferase; XT-II; Xylosyltransferase 2; Xylosyltransferase II
Gene Aliases: PXYLT2; SOS; UNQ3058/PRO9878; XT-II; XT2; xylT-II; XYLT2
UniProt ID: (Human) Q9H1B5
Entrez Gene ID: (Human) 64132
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.