Novus Biologicals
Manufacturer Code:NBP158119
Catalog # NBP158119
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to XRCC2(X-ray repair complementing defective repair in Chinese hamster cells 2) The peptide sequence was selected from the middle region of XRCC2. Peptide sequence CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp781P0919 DNA repair protein XRCC2 X-ray repair complementing defective repair in Chinese hamster cells 2 X-ray repair cross-complementing protein 2 X-ray repair complementing defective repair in Chinese hamster; DNA repair protein XRCC2; X-ray repair complementing defective repair in Chinese hamster cells 2; X-ray repair cross-complementing protein 2
Gene Aliases: FANCU; XRCC2
UniProt ID: (Human) O43543
Entrez Gene ID: (Human) 7516
Molecular Function:
DNA binding protein
DNA strand-pairing protein
hydrolase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.