Novus Biologicals
Manufacturer Code:NBP193567
Catalog # NBP193567
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSAAGEGEARPSTPQRQASNASKSNIAAANSGSNSSGATRASGKHRS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: X Kell blood group precursor-related family member 4 XK Kell blood group complex subunit-related family member 4 XK-related protein 4 XRG4; X Kell blood group precursor-related family, member 4; X-linked Kx blood group related 4; XK, Kell blood group complex subunit-related family, member 4; XK-related protein 4
Gene Aliases: KIAA1889; XKR4; XRG4
UniProt ID: (Human) Q5GH76
Entrez Gene ID: (Human) 114786
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.