Novus Biologicals
Manufacturer Code:NBP187828
Catalog # NBP187828
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Kell blood group precursor (McLeod phenotype); Kell blood group precursor (McLeod phenotype) Kell complex 37 kDa component KX Kx antigen membrane transport protein XK X1k XK Kell blood group complex subunit (McLeod syndrome) XKR1XK-related protein 1 X-linked Kx blood group (McLeod syndrome) XRG1; Kell complex 37 kDa component; Kx antigen; Membrane transport protein XK; neuroacanthocytosis; neurocanthocytosis; XK, Kell blood group complex subunit (McLeod syndrome); XK-related protein 1
Gene Aliases: KX; MCLDS; NA; NAC; X1k; XK; XKR1; XRG1
UniProt ID: (Human) P51811
Entrez Gene ID: (Human) 7504
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.