Novus Biologicals
Manufacturer Code:NBP258367
Catalog # NBP258367
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: crn-related protein kim1; DKFZp762C1015 HCNPcrn-related protein kim1 HCRN KIAA1177 NTC90 Protein HCNP SYF1 homolog RNA splicing factor SYF1pre-mRNA-splicing factor SYF1 XPA binding protein 2 XPA-binding protein 2; Pre-mRNA-splicing factor SYF1; Protein HCNP; SYF1 homolog, RNA splicing factor; SYF1 pre-mRNA-splicing factor; XPA-binding protein 2
Gene Aliases: HCNP; HCRN; KIAA1177; NTC90; PP3898; SYF1; XAB2
UniProt ID: (Human) Q9HCS7
Entrez Gene ID: (Human) 56949
Molecular Function:
DNA binding protein
RNA binding protein
damaged DNA-binding protein
mRNA processing factor
mRNA splicing factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.