Novus Biologicals
Manufacturer Code:NBP15699620UL
Catalog # NBP15699620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WNT3 (wingless-type MMTV integration site family member 3) The peptide sequence was selected from the middle region of WNT3 (NP_110380). Peptide sequence SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: INT4Proto-oncogene Int-4 homolog MGC131950 MGC138321 MGC138323 proto-oncogene Wnt-3 wingless-type MMTV integration site family member 3 WNT-3 proto-oncogene protein; Proto-oncogene Int-4 homolog; Proto-oncogene Wnt-3; wingless-type MMTV integration site family member 3; wingless-type MMTV integration site family, member 3; WNT-3 proto-oncogene protein
Gene Aliases: INT4; TETAMS; WNT3
UniProt ID: (Human) P56703
Entrez Gene ID: (Human) 7473
Molecular Function:
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.