Novus Biologicals
Manufacturer Code:NBP15793720UL
Catalog # NBP15793720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WNT9B (wingless-type MMTV integration site family member 9B) The peptide sequence was selected from the C terminal of WNT9B. Peptide sequence FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Protein Wnt-14b; Protein Wnt-14b wingless-type MMTV integration site family member 15 wingless-type MMTV integration site family member 9B WNT14Bprotein Wnt-9b WNT15Protein Wnt-15; Protein Wnt-15; Protein Wnt-9b; wingless-type MMTV integration site family member 9B; wingless-type MMTV integration site family, member 15
Gene Aliases: UNQ6973/PRO21956; WNT14B; WNT15; WNT9B
UniProt ID: (Human) O14905
Entrez Gene ID: (Human) 7484
Molecular Function: signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.