Novus Biologicals
Manufacturer Code:NBP160032
Catalog # NBP160032
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WNT5A(wingless-type MMTV integration site family member 5A) The peptide sequence was selected from the middle region of WNT5A. Peptide sequence GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hWNT5A protein Wnt-5a wingless-type MMTV integration site family member 5A WNT-5A protein; Protein Wnt-5a; wingless-type MMTV integration site family member 5A; wingless-type MMTV integration site family, member 5A; WNT-5A protein
Gene Aliases: hWNT5A; WNT5A
UniProt ID: (Human) P41221
Entrez Gene ID: (Human) 7474
Molecular Function: signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.