Novus Biologicals
Manufacturer Code:NBP179724
Catalog # NBP179724
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human WNT3AThe immunogen for this antibody is WNT3A (NP_149122). Peptide sequence MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC119418 MGC119419 MGC119420 protein Wnt-3a wingless-type MMTV integration site family member 3A; Protein Wnt-3a; wingless-type MMTV integration site family member 3A; wingless-type MMTV integration site family, member 3A
Gene Aliases: WNT3A
UniProt ID: (Human) P56704
Entrez Gene ID: (Human) 89780
Molecular Function:
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.