Novus Biologicals
Manufacturer Code:NBP153120
Catalog # NBP153120
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WNT2B (wingless-type MMTV integration site family member 2B) The peptide sequence was selected from the middle region of WNT2B. Peptide sequence LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Protein Wnt-13; Protein Wnt-13 protein Wnt-2b wingless-type MMTV integration site family member 2B WNT13XWNT2 Xenopus homolog of XWNT2wingless-type MMTV integration site family member 13; Protein Wnt-2b; wingless-type MMTV integration site family member 2B; wingless-type MMTV integration site family, member 13; wingless-type MMTV integration site family, member 2B; XWNT2, Xenopus, homolog of
Gene Aliases: WNT13; WNT2B
UniProt ID: (Human) Q93097
Entrez Gene ID: (Human) 7482
Molecular Function:
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.