Novus Biologicals
Manufacturer Code:NBP158361
Catalog # NBP158361
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WNK3(WNK lysine deficient protein kinase 3) The peptide sequence was selected from the N terminal of WNK3. Peptide sequence WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 FLJ30437 KIAA1566FLJ42662 PRKWNK3lysine deficient 3 WNK lysine deficient protein kinase 3; Protein kinase lysine-deficient 3; Protein kinase with no lysine 3; Serine/threonine-protein kinase WNK3
Gene Aliases: KIAA1566; PRKWNK3; WNK3
UniProt ID: (Human) Q9BYP7
Entrez Gene ID: (Human) 65267
Molecular Function: kinase non-receptor serine/threonine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.