Novus Biologicals
Manufacturer Code:NBP232434
Catalog # NBP232434
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.1 Erythrocyte 65 kDa protein HSAN2hereditary sensory neuropathy type II HSN2MGC163339 hWNK1 KDPMGC163341 KIAA0344 Kinase deficient protein p65 PHA2C PRKWNK1PSK prostate-derived sterile 20-like kinase Protein kinase lysine-deficient 1 Protein kinase with no lysine 1 protein kinase lysine deficient 1 serine/threonine-protein kinase WNK1 WNK lysine deficient protein kinase 1; Erythrocyte 65 kDa protein; hWNK1; Kinase deficient protein; p65; prostate-derived sterile 20-like kinase; Protein kinase lysine-deficient 1; Protein kinase with no lysine 1; protein phosphatase 1, regulatory subunit 167; Serine/threonine-protein kinase WNK1; serine/threonine-protein kinase WNK1 1; serine/threonine-protein kinase WNK1 2; WNK lysine deficient protein kinase 1 isoform
Gene Aliases: HSAN2; HSN2; KDP; KIAA0344; p65; PPP1R167; PRKWNK1; PSK; WNK1
UniProt ID: (Human) Q9H4A3
Entrez Gene ID: (Human) 65125
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.