Novus Biologicals
Manufacturer Code:NBP256099
Catalog # NBP256099
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10385 TCAB1WDR79telomerase Cajal body protein 1 WD repeat containing antisense to TP53 WD repeat domain 79 WD repeat-containing protein 79 WD40 protein Wrap53 WD40 repeat-containing protein encoding RNA antisense to p53 WD-encoding RNA antisense to p53; Telomerase Cajal body protein 1; WD repeat containing, antisense to TP53; WD repeat-containing protein 79; WD repeat-containing protein WRAP53; WD40 protein Wrap53; WD40 repeat-containing protein antisense to TP53; WD40 repeat-containing protein antisense to TP53 gene; WD40 repeat-containing protein encoding RNA antisense to p53; WRAP53beta
Gene Aliases: DKCB3; TCAB1; WDR79; WRAP53
UniProt ID: (Human) B3KPR9
Entrez Gene ID: (Human) 55135
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.