Novus Biologicals
Manufacturer Code:NBP180845
Catalog # NBP180845
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Meiotic recombination REC14 protein homolog; Meiotic recombination REC14 protein homolog REC14 recombination protein REC14 SKI8 WD repeat domain 61 WD repeat-containing protein 61; recombination protein REC14; Ski8; SKI8 homolog; WD repeat-containing protein 61; WD repeat-containing protein 61, N-terminally processed
Gene Aliases: REC14; SKI8; WDR61
UniProt ID: (Human) Q9GZS3
Entrez Gene ID: (Human) 80349
Molecular Function:
RNA binding protein
enzyme modulator
esterase
hydrolase
kinase inhibitor
kinase modulator
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.