Novus Biologicals
Manufacturer Code:NBP156804
Catalog # NBP156804
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to WDR53(WD repeat domain 53) The peptide sequence was selected from the middle region of WDR53. Peptide sequence NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G-beta repeat-containing protein MGC12928 MGC64882 WD repeat domain 53 WD repeat-containing protein 53; WD domain, G-beta repeat-containing protein; WD repeat-containing protein 53
Gene Aliases: WDR53
UniProt ID: (Human) Q7Z5U6
Entrez Gene ID: (Human) 348793
Molecular Function:
RNA binding protein
enzyme modulator
esterase
hydrolase
kinase inhibitor
kinase modulator
mRNA processing factor
mRNA splicing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.