Novus Biologicals
Manufacturer Code:NBP213520
Catalog # NBP213520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGT GLSGSYLSDEGHYWVGLDISPAMLDE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bud site selection protein 23 homolog; EC 2.1.1.- FLJ44236 HASJ4442 HUSSY-3 MGC19709 MGC2022 MGC5140 PP3381 WBMT Williams Beuren syndrome chromosome region 22 Williams Beuren syndrome chromosome region 22 protein Williams-Beuren candidate region putative methyltransferase Williams-Beuren syndrome chromosomal region 22 protein; Metastasis-related methyltransferase 1; Probable 18S rRNA (guanine-N(7))-methyltransferase; ribosome biogenesis methyltransferase WBSCR22; rRNA methyltransferase and ribosome maturation factor; Williams Beuren syndrome chromosome region 22; Williams-Beuren candidate region putative methyltransferase; Williams-Beuren syndrome chromosomal region 22 protein
Gene Aliases: BUD23; HASJ4442; HUSSY-03; HUSSY-3; MERM1; PP3381; WBMT; WBSCR22
UniProt ID: (Human) O43709
Entrez Gene ID: (Human) 114049
Molecular Function:
methyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.