Novus Biologicals
Manufacturer Code:NBP17949020UL
Catalog # NBP17949020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: domain-containing binding protein 4; domain-containing binding protein 4 WW domain binding protein 4 (formin binding protein 21); formin binding protein 21; Formin-binding protein 21; WBP-4; WW domain-binding protein 4; WW domain-containing binding protein 4; WW domain-containing-binding protein 4
Gene Aliases: FBP21; FNBP21; WBP4
UniProt ID: (Human) O75554
Entrez Gene ID: (Human) 11193
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.