Novus Biologicals
Manufacturer Code:NBP238551
Catalog # NBP238551
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRKSEDNSAVPLAKAAPKSGPSVPVSVQTKDDVYEDFMKEME |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp779M1063 Npw38-binding protein Npw38-binding protein NpwBP NpwBP NPWBPsplicing factor PQBP1 and PP1 interacting SH3 domain-binding protein SNP70 SIPP1WW domain-binding protein 11 SNP70 Splicing factor that interacts with PQBP-1 and PP1 WBP-11 WW domain binding protein 11; Npw38-binding protein; Npw38-binding protein NpwBP; NpwBP; protein phosphatase 1, regulatory subunit 165; SH3 domain-binding protein SNP70; Splicing factor that interacts with PQBP-1 and PP1; splicing factor, PQBP1 and PP1 interacting; WBP-11; WW domain-binding protein 11
Gene Aliases: NPWBP; PPP1R165; SIPP1; SNP70; WBP-11; WBP11
UniProt ID: (Human) Q9Y2W2
Entrez Gene ID: (Human) 51729
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.