Novus Biologicals
Manufacturer Code:NBP237912
Catalog # NBP237912
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: IMD2 Protein WAVE-2 SCAR2suppressor of cyclic-AMP receptor (WASP-family) Verprolin homology domain-containing protein 2 WAS protein family member 2 WASP family Verprolin-homologous protein 2 WAVE2dJ393P12.2 wiskWASP family protein member 2; Protein WAVE-2; putative Wiskott-Aldrich syndrome protein family member 4; suppressor of cyclic-AMP receptor (WASP-family); Verprolin homology domain-containing protein 2; WAS protein family, member 2; WASP family protein member 2; WASP family protein member 4; WASP family Verprolin-homologous protein 2; Wiskott-Aldrich syndrome protein family member 2
Gene Aliases: dJ393P12.2; IMD2; SCAR2; WASF2; WASF4; WAVE2
UniProt ID: (Human) Q9Y6W5
Entrez Gene ID: (Human) 10163
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.