Novus Biologicals
Manufacturer Code:NBP230952
Catalog # NBP230952
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MVti1 vesicle transport through interaction with t-SNAREs homolog 1A vesicle transport through interaction with t-SNAREs homolog 1A (yeast); SNARE Vti1a-beta protein; Vesicle transport through interaction with t-SNAREs homolog 1A; Vesicle transport v-SNARE protein Vti1-like 2; Vti1-rp2
Gene Aliases: MMDS3; MVti1; Vti1-rp2; VTI1A; VTI1RP2
UniProt ID: (Human) Q96AJ9
Entrez Gene ID: (Human) 143187
Molecular Function:
SNARE protein
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.