Novus Biologicals
Manufacturer Code:NBP183798
Catalog # NBP183798
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10979 FLJ41112 FLJ61757 HCCS1 hVps53L MGC39512 pp13624 vacuolar protein sorting 53 (yeast) vacuolar protein sorting 53 homolog (S. cerevisiae) vacuolar protein sorting-associated protein 53 homolog; Vacuolar protein sorting-associated protein 53 homolog; VPS53 GARP complex subunit
Gene Aliases: HCCS1; hVps53L; PCH2E; PP13624; VPS53
UniProt ID: (Human) Q5VIR6
Entrez Gene ID: (Human) 55275
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.