Novus Biologicals
Manufacturer Code:NBP154618
Catalog # NBP154618
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22197 hVPS4 Protein SKD2 SKD1 SKD1A SKD2 vacuolar protein sorting 4 homolog A (S. cerevisiae) vacuolar protein sorting 4A (yeast homolog) vacuolar protein sorting factor 4A vacuolar protein sorting-associated protein 4A vacuolar sorting protein 4 VPS4-1SKD1-homolog VPS4vacuolar protein sorting 4A (yeast); hVPS4; Protein SKD2; SKD1-homolog; vacuolar protein sorting factor 4A; Vacuolar protein sorting-associated protein 4A; vacuolar sorting protein 4; VPS4-1; VPS4A
Gene Aliases: SKD1; SKD1A; SKD2; VPS4; VPS4-1; VPS4A
UniProt ID: (Human) Q9UN37
Entrez Gene ID: (Human) 27183
Molecular Function:
cytoskeletal protein
microtubule family cytoskeletal protein
non-motor microtubule binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.