Novus Biologicals
Manufacturer Code:NBP233641
Catalog # NBP233641
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Dermal papilla-derived protein 9; Dermal papilla-derived protein 9 DERP9 DERP9hVps25 EAP20 EAP20FAP20 ELL-associated protein of 20 kDa ESCRT-II complex subunit VPS25 FAP20 MGC10540 vacuolar protein sorting 25 (yeast) vacuolar protein sorting 25 homolog (S. cerevisiae) vacuolar protein-sorting-associated protein 25; ELL-associated protein of 20 kDa; ESCRT-II complex subunit VPS25; hVps25; Vacuolar protein-sorting-associated protein 25
Gene Aliases: DERP9; EAP20; FAP20; VPS25
UniProt ID: (Human) B2R581
Entrez Gene ID: (Human) 84313
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.