Novus Biologicals
Manufacturer Code:NBP247583
Catalog # NBP247583
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hVPS11; hVPS11 PEP5 RING finger protein 108 RNF108END1 vacuolar protein sorting 11 (yeast homolog) vacuolar protein sorting 11 homolog (S. cerevisiae) vacuolar protein sorting protein 11 vacuolar protein sorting-associated protein 11 homolog; RING finger protein 108; vacuolar protein sorting 11 homolog; Vacuolar protein sorting-associated protein 11 homolog; VPS11 CORVET/HOPS core subunit
Gene Aliases: END1; HLD12; hVPS11; PEP5; PP3476; RNF108; VPS11
UniProt ID: (Human) Q9H270
Entrez Gene ID: (Human) 55823
Molecular Function: membrane traffic protein membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.