Novus Biologicals
Manufacturer Code:NBP18006520UL
Catalog # NBP18006520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2 Synthetic peptide directed towards the N terminal of human VDAC2. Peptide sequence MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ23841 hVDAC2 Outer mitochondrial membrane protein porin 2 POR VDAC-2 voltage-dependent anion channel 2 voltage-dependent anion-selective channel protein 2; Outer mitochondrial membrane protein porin 2; VDAC-2; voltage-dependent anion channel 2; Voltage-dependent anion-selective channel protein 2
Gene Aliases: POR; VDAC2
UniProt ID: (Human) P45880
Entrez Gene ID: (Human) 7417
Molecular Function: anion channel ion channel transporter voltage-gated ion channel
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.