Novus Biologicals
Manufacturer Code:NBP15536520UL
Catalog # NBP15536520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to VARS(valyl-tRNA synthetase) The peptide sequence was selected from the middle region of VARS. Peptide sequence AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1 EC 6.1.1.9 G7AVARS1 Protein G7a valine tRNA ligase 1 cytoplasmic Valine--tRNA ligase ValRS valyl-tRNA synthetase valyl-tRNA synthetase 2 VARS2valRS; Protein G7a; valine tRNA ligase 1, cytoplasmic; Valine--tRNA ligase; ValRS; Valyl-tRNA synthetase; valyl-tRNA synthetase 2
Gene Aliases: G7A; VARS; VARS1; VARS2
UniProt ID: (Human) P26640
Entrez Gene ID: (Human) 7407
Molecular Function:
aminoacyl-tRNA synthetase
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.