Novus Biologicals
Manufacturer Code:NBP198382
Catalog # NBP198382
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Utp15 - middle region. Peptide sequence DETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIKGKNYLKQRDD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Src-associated protein SAW; U3 small nucleolar ribonucleoprotein homolog (yeast) U3 small nucleolar RNA-associated protein 15 homolog UTP15 U3 small nucleolar ribonucleoprotein homolog (S. cerevisiae); U3 small nucleolar RNA-associated protein 15 homolog; UTP15 SSU processome component; UTP15, U3 small nucleolar ribonucleoprotein, homolog
Gene Aliases: NET21; UTP15
UniProt ID: (Human) Q8TED0
Entrez Gene ID: (Human) 84135
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.