Novus Biologicals
Manufacturer Code:NBP15696420UL
Catalog # NBP15696420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UTP14A (UTP14 U3 small nucleolar ribonucleoprotein homolog A (yeast)) The peptide sequence was selected from the N terminal of UTP14A. Peptide sequence KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Antigen NY-CO-16; Antigen NY-CO-16 dJ537K23.3 FLJ37089 NYCO16 NY-CO-16 SDCCAG16 Serologically defined colon cancer antigen 16KIAA0266 U3 small nucleolar RNA-associated protein 14 homolog A UTP14 U3 small nucleolar ribonucleoprotein homolog A (yeast); Serologically defined colon cancer antigen 16; U3 small nucleolar RNA-associated protein 14 homolog A; UTP14, U3 small nucleolar ribonucleoprotein, homolog A; UTP14A small subunit (SSU) processome component
Gene Aliases: dJ537K23.3; NYCO16; SDCCAG16; UTP14A
UniProt ID: (Human) Q9BVJ6
Entrez Gene ID: (Human) 10813
Molecular Function:
RNA binding protein
nuclease
nucleic acid binding
ribosomal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.