Novus Biologicals
Manufacturer Code:NBP17974920UL
Catalog # NBP17974920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Deubiquitinating enzyme FAF-Y; Deubiquitinating enzyme FAF-Y DFFRYFLJ33043 EC 3.1.2.15 EC 3.4.19.12 Fat facets protein-related Y-linked probable ubiquitin carboxyl-terminal hydrolase FAF-Y ubiquitin specific peptidase 9 Y-linked ubiquitin specific peptidase 9 Y-linked (fat facets-like Drosophila) ubiquitin thioesterase FAF-Y Ubiquitin thiolesterase FAF-Y ubiquitin-specific processing protease FAF-Y Ubiquitin-specific protease 9 Y chromosome Ubiquitin-specific-processing protease FAF-Y; Fat facets protein-related, Y-linked; Probable ubiquitin carboxyl-terminal hydrolase FAF-Y; ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila); Ubiquitin thioesterase FAF-Y; ubiquitin thiolesterase FAF-Y; ubiquitin-specific processing protease FAF-Y; Ubiquitin-specific protease 9, Y chromosome; Ubiquitin-specific-processing protease FAF-Y
Gene Aliases: DFFRY; SPGFY2; USP9Y
UniProt ID: (Human) O00507
Entrez Gene ID: (Human) 8287
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.