Novus Biologicals
Manufacturer Code:NBP213510
Catalog # NBP213510
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQDLENKE MSKEWFLFNDSRVTFTSFQSVQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Deubiquitinating enzyme 38; Deubiquitinating enzyme 38 EC 3.4.19.12 HP43.8KDFLJ35970 KIAA1891ubiquitin specific protease 38 ubiquitin carboxyl-terminal hydrolase 38 ubiquitin specific peptidase 38 ubiquitin thioesterase 38 Ubiquitin thiolesterase 38 Ubiquitin-specific-processing protease 38; HP43.8KD; Ubiquitin carboxyl-terminal hydrolase 38; ubiquitin specific protease 38; Ubiquitin thioesterase 38; ubiquitin thiolesterase 38; Ubiquitin-specific-processing protease 38
Gene Aliases: HP43.8KD; KIAA1891; USP38
UniProt ID: (Human) Q8NB14
Entrez Gene ID: (Human) 84640
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.