Novus Biologicals
Manufacturer Code:NBP185950
Catalog # NBP185950
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Deubiquitinating enzyme 1; Deubiquitinating enzyme 1 EC 3.1.2.15 EC 3.4.19.12 hUBP ubiquitin carboxyl terminal hydrolase 1 ubiquitin carboxyl-terminal hydrolase 1 ubiquitin specific peptidase 1 ubiquitin specific processing protease 1 ubiquitin specific protease 1 ubiquitin thioesterase 1 Ubiquitin thiolesterase 1 Ubiquitin-specific-processing protease 1 UBP; hUBP; ubiquitin carboxyl terminal hydrolase 1; Ubiquitin carboxyl-terminal hydrolase 1; ubiquitin specific processing protease 1; ubiquitin specific protease 1; Ubiquitin thioesterase 1; ubiquitin thiolesterase 1; Ubiquitin-specific-processing protease 1
Gene Aliases: UBP; USP1
UniProt ID: (Human) O94782
Entrez Gene ID: (Human) 7398
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.