Novus Biologicals
Manufacturer Code:NBP189190
Catalog # NBP189190
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AIE75 AIE-75 Antigen NY-CO-38/NY-CO-37 Autoimmune enteropathy-related antigen AIE-75 deafness autosomal recessive 18 DFNB18 harmonin NY-CO-37 NY-CO-38 PDZ-45 PDZ73 PDZ-73 PDZ-73/NY-CO-38 Protein PDZ-73 Renal carcinoma antigen NY-REN-3 ush1cpst Usher syndrome 1C (autosomal recessive severe) Usher syndrome type-1C protein; Antigen NY-CO-38/NY-CO-37; Autoimmune enteropathy-related antigen AIE-75; Harmonin; Protein PDZ-73; Renal carcinoma antigen NY-REN-3; Usher syndrome 1C (autosomal recessive, severe); Usher syndrome type-1C protein
Gene Aliases: AIE-75; AIE75; DFNB18; DFNB18A; NY-CO-37; NY-CO-38; PDZ-45; PDZ-73; PDZ-73/NY-CO-38; PDZ73; PDZD7C; USH1C; ush1cpst
UniProt ID: (Human) Q9Y6N9
Entrez Gene ID: (Human) 10083
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.