Novus Biologicals
Manufacturer Code:NBP258447
Catalog # NBP258447
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C9orf74 chromosome 9 open reading frame 74 MGC2668 ubiquitin related modifier 1 ubiquitin related modifier 1 homolog ubiquitin related modifier 1 homolog (S. cerevisiae) ubiquitin-related modifier 1 homolog; ubiquitin related modifier 1 homolog; Ubiquitin-related modifier 1; ubiquitin-related modifier 1 homolog; URM1
Gene Aliases: C9orf74; URM1
UniProt ID: (Human) Q9BTM9
Entrez Gene ID: (Human) 81605
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.