Novus Biologicals
Manufacturer Code:NBP187826
Catalog # NBP187826
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 8 kDa subunit 9; Complex III subunit 5; Complex III subunit 5 Cytochrome b-c1 complex subunit 5 cytochrome b-c1 complex subunit Rieske mitochondrial EC 1.10.2.2 Rieske iron-sulfur protein RIP1 RIS1 RISPUbiquinol-cytochrome c reductase iron-sulfur subunit ubiquinol-cytochrome c reductase Rieske iron-sulfur polypeptide 1 UQCR5; Complex III subunit IX; Cytochrome b-c1 complex subunit 11; Cytochrome b-c1 complex subunit 5; Cytochrome b-c1 complex subunit 9; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Rieske iron-sulfur protein; Rieske protein UQCRFS1; RISP; Su9; Ubiquinol-cytochrome c reductase 8 kDa protein; Ubiquinol-cytochrome c reductase iron-sulfur subunit; UQCRFS1 mitochondrial targeting sequence; UQCRFS1 MTS
Gene Aliases: RIP1; RIS1; RISP; UQCR5; UQCRFS1
UniProt ID: (Human) P47985
Entrez Gene ID: (Human) 7386
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.