Novus Biologicals
Manufacturer Code:NBP181708
Catalog # NBP181708
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hRG4; hRG4 HRG4POC7 centriolar protein homolog A POC7 POC7A protein unc-119 homolog A Retinal protein 4 RG4 unc119 (C.elegans) homolog unc-119 homolog (C. elegans); POC7 centriolar protein homolog A; Protein unc-119 homolog A; Retinal protein 4; unc-119 homolog
Gene Aliases: HRG4; IMD13; POC7; POC7A; RG4; UNC119
UniProt ID: (Human) Q13432
Entrez Gene ID: (Human) 9094
Molecular Function:
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.