Novus Biologicals
Manufacturer Code:NBP256576
Catalog # NBP256576
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATG1; ATG1 ATG1 autophagy related 1 homolog ATG1A EC 2.7.11 EC 2.7.11.1 FLJ38455 FLJ46475 KIAA0722 serine/threonine-protein kinase ULK1 UNC51 unc-51 (C. elegans)-like kinase 1 Unc51.1 Unc-51-like kinase 1 unc-51-like kinase 1 (C. elegans); ATG1 autophagy related 1 homolog; Autophagy-related protein 1 homolog; Serine/threonine-protein kinase ULK1; Unc-51-like kinase 1
Gene Aliases: ATG1; ATG1A; hATG1; KIAA0722; ULK1; UNC51; Unc51.1
UniProt ID: (Human) O75385
Entrez Gene ID: (Human) 8408
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.