Novus Biologicals
Manufacturer Code:NBP256391
Catalog # NBP256391
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; Ceramide UDP-galactosyltransferase Cerebroside synthase CGT2-hydroxyacylsphingosine 1-beta-galactosyltransferase EC 2.4.1 EC 2.4.1.45 UDP glycosyltransferase 8 UDP-galactose ceramide galactosyltransferase UDP-galactose-ceramide galactosyltransferase UGT4 uridine diphosphate glycosyltransferase 8; Cerebroside synthase; UDP-galactose ceramide galactosyltransferase; UDP-galactose-ceramide galactosyltransferase; uridine diphosphate glycosyltransferase 8
Gene Aliases: CGT; UGT4; UGT8
UniProt ID: (Human) Q16880
Entrez Gene ID: (Human) 7368
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.