Novus Biologicals
Manufacturer Code:NBP169689
Catalog # NBP169689
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UGT1A9(UDP glucuronosyltransferase 1 family polypeptide A9) The peptide sequence was selected from the N terminal of UGT1A9. Peptide sequence LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.1.17 GNT1 HLUGP4 LUGP4 polypeptide A9 UDP glucuronosyltransferase 1 family polypeptide A9 UDP-glucuronosyltransferase 1-9 UDP-glucuronosyltransferase 1A9 UDP-glucuronosyltransferase 1-I UDPGT UDPGT 1-9 UGT1 UGT1*9 UGT1.9 UGT1-09 UGT1-9 UGT1AI UGT1I UGT-1I; lugP4; UDP glucuronosyltransferase 1 family, polypeptide A9; UDP glycosyltransferase 1 family, polypeptide A9; UDP-glucuronosyltransferase 1 family polypeptide A9s; UDP-glucuronosyltransferase 1-9; UDP-glucuronosyltransferase 1-I; UDP-glucuronosyltransferase 1A9; UDPGT 1-9; UGT-1I; UGT1A9
Gene Aliases: GNT1; HLUGP4; LUGP4; UDPGT; UDPGT 1-9; UGT-1I; UGT1; UGT1-09; UGT1-9; UGT1.9; UGT1A9; UGT1A9S; UGT1AI; UGT1I
UniProt ID: (Human) O60656
Entrez Gene ID: (Human) 54600
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.