Novus Biologicals
Manufacturer Code:NBP19133520UL
Catalog # NBP19133520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human UGT1A7. Peptide sequence VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GNT1 polypeptide A7 UDP glucuronosyltransferase 1 family polypeptide A7 UDP-glucuronosyltransferase 1-7 UDP-glucuronosyltransferase 1-G UDPGT 1-7 UGT1 UGT1-07 UGT1G; UDP glucuronosyltransferase 1 family, polypeptide A7; UDP glycosyltransferase 1 family, polypeptide A7; UDP-glucuronosyltransferase 1 family polypeptide A7s; UDP-glucuronosyltransferase 1-7; UDP-glucuronosyltransferase 1-G; UDP-glucuronosyltransferase 1A7; UDPGT 1-7; UGT-1G; UGT1A7
Gene Aliases: GNT1; UDPGT; UDPGT 1-7; UGT-1G; UGT1; UGT1-07; UGT1.7; UGT1A7; UGT1G
UniProt ID: (Human) Q9HAW7
Entrez Gene ID: (Human) 54577
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.