Novus Biologicals
Manufacturer Code:NBP155519
Catalog # NBP155519
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UGP2(UDP-glucose pyrophosphorylase 2) The peptide sequence was selected from the N terminal of UGP2. Peptide sequence TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7.9 pHC379 UDPG UDP-glucose diphosphorylase UDP-glucose pyrophosphorylase UDP-glucose pyrophosphorylase 2 UDPGP UDPGP2 UGP1 UGPase UGPase 2 UGPP2 uridyl diphosphate glucose pyrophosphorylase 2 UTP-glucose-1-phosphate uridyltransferase UTP--glucose-1-phosphate uridylyltransferase UTP--glucose-1-phosphate uridylyltransferase 2; testis tissue sperm-binding protein Li 58p; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase 1; UDPGP; UGPase 2; uridyl diphosphate glucose pyrophosphorylase 2; Uridyl diphosphate glucose pyrophosphorylase-1; UTP--glucose-1-phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2; UTP-glucose-1-phosphate uridyltransferase
Gene Aliases: pHC379; UDPG; UDPGP; UDPGP2; UGP1; UGP2; UGPP1; UGPP2
UniProt ID: (Human) Q16851
Entrez Gene ID: (Human) 7360
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.