Novus Biologicals
Manufacturer Code:NBP170764
Catalog # NBP170764
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UGCGL1 (UDP-glucose glycoprotein glucosyltransferase 1) The peptide sequence was selected from the middle region of UGCGL1. Peptide sequence AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ21763 GT HUGT1 UDP--Glc:glycoprotein glucosyltransferase UDP-glucose ceramide glucosyltransferase-like 1 UDP-glucose glycoprotein glucosyltransferase 1 UGCGL1 UGGT UGT1 UGTR; UDP--Glc:glycoprotein glucosyltransferase; UDP-glucose ceramide glucosyltransferase-like 1; UDP-glucose:glycoprotein glucosyltransferase 1; UGT1
Gene Aliases: GT; HUGT1; UGCGL1; UGGT; UGGT1; UGT1; UGTR
UniProt ID: (Human) Q9NYU2
Entrez Gene ID: (Human) 56886
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.