Novus Biologicals
Manufacturer Code:NBP179299
Catalog # NBP179299
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human UGCGL2The immunogen for this antibody is UGCGL2. Peptide sequence KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ10873 HUGT2 MGC117360 UDP-Glc:glycoprotein glucosyltransferase 2 UDP-glucose ceramide glucosyltransferase-like 1 UDP-glucose glycoprotein glucosyltransferase 2; UDP--Glc:glycoprotein glucosyltransferase 2; UDP-Glc:glycoprotein glucosyltransferase 2; UDP-glucose ceramide glucosyltransferase-like 1; UDP-glucose ceramide glucosyltransferase-like 2; UDP-glucose:glycoprotein glucosyltransferase 2; UGT2
Gene Aliases: HUGT2; UGCGL2; UGGT2; UGT2
UniProt ID: (Human) Q9NYU1
Entrez Gene ID: (Human) 55757
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.