Novus Biologicals
Manufacturer Code:NBP15543820UL
Catalog # NBP15543820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human UFL1 Peptide sequence: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E3 UFM1-protein ligase 1; E3 UFM1-protein ligase 1 EC 6.3.2.- KIAA0776 LZAP-binding protein NLBPnovel LZAP-binding protein RP3-393D12.1 UFL1; E3 UFM1-protein transferase 1; LZAP-binding protein; Multiple alpha-helix protein located at ER; Novel LZAP-binding protein; Regulator of C53/LZAP and DDRGK1; Regulator of CDK5RAP3 and DDRGK1; UFM1-specific ligase 1
Gene Aliases: KIAA0776; MAXER; NLBP; RCAD; UFL1
UniProt ID: (Human) O94874
Entrez Gene ID: (Human) 23376
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.