Novus Biologicals
Manufacturer Code:NBP156353
Catalog # NBP156353
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LOC51035(SAPK substrate protein 1) The peptide sequence was selected from the middle region of LOC51035. Peptide sequence RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2B28 LOC51035 SAKS1UBA/UBX 33.3 kDa protein SAPK substrate protein 1 UBX domain protein 1 UBX domain-containing protein 1 UBXD10; SAPK substrate protein 1; UBA/UBX 33.3 kDa protein; UBX domain-containing protein 1
Gene Aliases: 2B28; SAKS1; UBXD10; UBXN1
UniProt ID: (Human) Q04323
Entrez Gene ID: (Human) 51035
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.