Novus Biologicals
Manufacturer Code:NBP15498220UL
Catalog # NBP15498220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UBR2(ubiquitin protein ligase E3 component n-recognin 2) The peptide sequence was selected from the C terminal of UBR2. Peptide sequence QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA49A4.1 C6orf133MGC71112 chromosome 6 open reading frame 133 dJ242G1.1 dJ392M17.3 DKFZp686C08114 E3 ubiquitin-protein ligase UBR2 EC 6.3.2.- KIAA0349FLJ36357 N-recognin-2 RP3-392M17.3 ubiquitin protein ligase E3 component n-recognin 2 Ubiquitin-protein ligase E3-alpha-2 Ubiquitin-protein ligase E3-alpha-II; E3 ubiquitin-protein ligase UBR2; N-recognin-2; RING-type E3 ubiquitin transferase UBR2; Ubiquitin-protein ligase E3-alpha-2; Ubiquitin-protein ligase E3-alpha-II
Gene Aliases: bA49A4.1; C6orf133; dJ242G1.1; dJ392M17.3; KIAA0349; UBR2
UniProt ID: (Human) Q8IWV8
Entrez Gene ID: (Human) 23304
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.