Novus Biologicals
Manufacturer Code:NBP15497620UL
Catalog # NBP15497620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UBR1(ubiquitin protein ligase E3 component n-recognin 1) The peptide sequence was selected from the N terminal of UBR1. Peptide sequence YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E3 ubiquitin-protein ligase UBR1; E3 ubiquitin-protein ligase UBR1 E3a ligase EC 6.3.2.- JBS MGC142065 MGC142067 N-recognin-1 ubiquitin ligase E3 alpha-I ubiquitin protein ligase E3 component n-recognin 1 ubiquitin-protein ligase E3-alpha Ubiquitin-protein ligase E3-alpha-1 Ubiquitin-protein ligase E3-alpha-I; E3a ligase; N-recognin-1; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin-protein ligase E3-alpha; Ubiquitin-protein ligase E3-alpha-1; Ubiquitin-protein ligase E3-alpha-I
Gene Aliases: JBS; UBR1
UniProt ID: (Human) Q8IWV7
Entrez Gene ID: (Human) 197131
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.