Novus Biologicals
Manufacturer Code:NBP159757
Catalog # NBP159757
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to UBE2J1(ubiquitin-conjugating enzyme E2 J1 (UBC6 homolog yeast)) The peptide sequence was selected from the N terminal of UBE2J1. Peptide sequence METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-76 EC 6.3.2.19 HSPC153 HSPC205 HSU93243 HsUBC6e MGC12555 NCUBE-1 NCUBE1HSUBC6e Non-canonical ubiquitin-conjugating enzyme 1 non-canonical ubquitin conjugating enzyme 1 Ubc6p ubiquitin-conjugating enzyme E2 J1 ubiquitin-conjugating enzyme E2 J1 (UBC6 homolog yeast) Yeast ubiquitin-conjugating enzyme UBC6 homolog E; E2 ubiquitin-conjugating enzyme J1; HSUBC6e; NCUBE-1; Non-canonical ubiquitin-conjugating enzyme 1; ubiquitin conjugating enzyme E2, J1; Ubiquitin-conjugating enzyme E2 J1; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast); ubiquitin-conjugating enzyme E2, J1, U; Yeast ubiquitin-conjugating enzyme UBC6 homolog E
Gene Aliases: CGI-76; HSPC153; HSPC205; HSU93243; NCUBE-1; NCUBE1; UBC6; UBC6E; Ubc6p; UBE2J1
UniProt ID: (Human) Q9Y385
Entrez Gene ID: (Human) 51465
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.