Novus Biologicals
Manufacturer Code:NBP191463
Catalog # NBP191463
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human UBAC2. Peptide sequence YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ26351 FLJ30001 FLJ42413 MGC90487 PHGDHL1 phosphoglycerate dehydrogenase-like protein 1 RP11-178C10.1 UBA domain containing 2 ubiquitin-associated domain-containing protein 2; phosphoglycerate dehydrogenase like 1; Phosphoglycerate dehydrogenase-like protein 1; RP11-178C10.1; UBA domain-containing protein 2; Ubiquitin-associated domain-containing protein 2
Gene Aliases: PHGDHL1; PSEC0110; UBAC2
UniProt ID: (Human) Q8NBM4
Entrez Gene ID: (Human) 337867
Molecular Function:
aspartic protease
hydrolase
protease
transcription cofactor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.