Novus Biologicals
Manufacturer Code:NBP192555
Catalog # NBP192555
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLPCRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGKVILER |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7 EC 2.7.7.- EC 2.7.7.23 EC 2.7.7.27 RP11-229P13.18 UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 UDP-N-acteylglucosamine pyrophosphorylase 1-like 1; UDP-N-acetylhexosamine pyrophosphorylase-like protein 1; UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Gene Aliases: UAP1L1
UniProt ID: (Human) Q3KQV9
Entrez Gene ID: (Human) 91373
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.