Novus Biologicals
Manufacturer Code:NBP17415120UL
Catalog # NB7415120UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of UAP1L1 Immunizing peptide sequence KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7 EC 2.7.7.- EC 2.7.7.23 EC 2.7.7.27 RP11-229P13.18 UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 UDP-N-acteylglucosamine pyrophosphorylase 1-like 1; UDP-N-acetylhexosamine pyrophosphorylase-like protein 1; UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Gene Aliases: UAP1L1
UniProt ID: (Human) Q3KQV9
Entrez Gene ID: (Human) 91373
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.